Protein Description: calpain 8
Gene Name: CAPN8
Alternative Gene Name: nCL-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038599: 81%, ENSRNOG00000003468: 81%
Entrez Gene ID: 388743
Uniprot ID: A6NHC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAPN8
Alternative Gene Name: nCL-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038599: 81%, ENSRNOG00000003468: 81%
Entrez Gene ID: 388743
Uniprot ID: A6NHC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTAL |
| Documents & Links for Anti CAPN8 pAb (ATL-HPA073939) | |
| Datasheet | Anti CAPN8 pAb (ATL-HPA073939) Datasheet (External Link) |
| Vendor Page | Anti CAPN8 pAb (ATL-HPA073939) at Atlas |
| Documents & Links for Anti CAPN8 pAb (ATL-HPA073939) | |
| Datasheet | Anti CAPN8 pAb (ATL-HPA073939) Datasheet (External Link) |
| Vendor Page | Anti CAPN8 pAb (ATL-HPA073939) |