Protein Description: cullin-associated and neddylation-dissociated 1
Gene Name: CAND1
Alternative Gene Name: DKFZp434M1414, KIAA0829, TIP120, TIP120A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020114: 100%, ENSRNOG00000007834: 100%
Entrez Gene ID: 55832
Uniprot ID: Q86VP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAND1
Alternative Gene Name: DKFZp434M1414, KIAA0829, TIP120, TIP120A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020114: 100%, ENSRNOG00000007834: 100%
Entrez Gene ID: 55832
Uniprot ID: Q86VP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEI |
| Documents & Links for Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) | |
| Datasheet | Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) at Atlas |
| Documents & Links for Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) | |
| Datasheet | Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAND1 pAb (ATL-HPA069053 w/enhanced validation) |