Anti CAMLG pAb (ATL-HPA056472)

Atlas Antibodies

Catalog No: ATL-HPA056472-25

• 
• 

Product Description

Protein Description: calcium modulating ligand
Gene Name: CAMLG
Alternative Gene Name: CAML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021501: 84%, ENSRNOG00000021911: 84%
Entrez Gene ID: 819
Uniprot ID: P49069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT
• Gene Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT
• Gene ID - Mouse: ENSMUSG00000021501
• Gene ID - Rat: ENSRNOG00000021911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.