Description
Product Description
Protein Description: calcium modulating ligand
Gene Name: CAMLG
Alternative Gene Name: CAML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021501: 84%, ENSRNOG00000021911: 84%
Entrez Gene ID: 819
Uniprot ID: P49069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAMLG
Alternative Gene Name: CAML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021501: 84%, ENSRNOG00000021911: 84%
Entrez Gene ID: 819
Uniprot ID: P49069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT |
Gene Sequence | MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT |
Gene ID - Mouse | ENSMUSG00000021501 |
Gene ID - Rat | ENSRNOG00000021911 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CAMLG pAb (ATL-HPA056472) | |
Datasheet | Anti CAMLG pAb (ATL-HPA056472) Datasheet (External Link) |
Vendor Page | Anti CAMLG pAb (ATL-HPA056472) at Atlas Antibodies |
Documents & Links for Anti CAMLG pAb (ATL-HPA056472) | |
Datasheet | Anti CAMLG pAb (ATL-HPA056472) Datasheet (External Link) |
Vendor Page | Anti CAMLG pAb (ATL-HPA056472) |