Description
Product Description
Protein Description: calmodulin-lysine N-methyltransferase
Gene Name: CAMKMT
Alternative Gene Name: C2orf34, CLNMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071037: 87%, ENSRNOG00000030629: 88%
Entrez Gene ID: 79823
Uniprot ID: Q7Z624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAMKMT
Alternative Gene Name: C2orf34, CLNMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071037: 87%, ENSRNOG00000030629: 88%
Entrez Gene ID: 79823
Uniprot ID: Q7Z624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG |
Gene Sequence | SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG |
Gene ID - Mouse | ENSMUSG00000071037 |
Gene ID - Rat | ENSRNOG00000030629 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CAMKMT pAb (ATL-HPA067912) | |
Datasheet | Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link) |
Vendor Page | Anti CAMKMT pAb (ATL-HPA067912) at Atlas Antibodies |
Documents & Links for Anti CAMKMT pAb (ATL-HPA067912) | |
Datasheet | Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link) |
Vendor Page | Anti CAMKMT pAb (ATL-HPA067912) |