Anti CAMKMT pAb (ATL-HPA067912)

Catalog No:
ATL-HPA067912-25
$303.00

Description

Product Description

Protein Description: calmodulin-lysine N-methyltransferase
Gene Name: CAMKMT
Alternative Gene Name: C2orf34, CLNMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071037: 87%, ENSRNOG00000030629: 88%
Entrez Gene ID: 79823
Uniprot ID: Q7Z624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG
Gene Sequence SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG
Gene ID - Mouse ENSMUSG00000071037
Gene ID - Rat ENSRNOG00000030629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CAMKMT pAb (ATL-HPA067912)
Datasheet Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link)
Vendor Page Anti CAMKMT pAb (ATL-HPA067912) at Atlas Antibodies

Documents & Links for Anti CAMKMT pAb (ATL-HPA067912)
Datasheet Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link)
Vendor Page Anti CAMKMT pAb (ATL-HPA067912)

Product Description

Protein Description: calmodulin-lysine N-methyltransferase
Gene Name: CAMKMT
Alternative Gene Name: C2orf34, CLNMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071037: 87%, ENSRNOG00000030629: 88%
Entrez Gene ID: 79823
Uniprot ID: Q7Z624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG
Gene Sequence SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG
Gene ID - Mouse ENSMUSG00000071037
Gene ID - Rat ENSRNOG00000030629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CAMKMT pAb (ATL-HPA067912)
Datasheet Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link)
Vendor Page Anti CAMKMT pAb (ATL-HPA067912) at Atlas Antibodies

Documents & Links for Anti CAMKMT pAb (ATL-HPA067912)
Datasheet Anti CAMKMT pAb (ATL-HPA067912) Datasheet (External Link)
Vendor Page Anti CAMKMT pAb (ATL-HPA067912)