Anti CAMKK2 pAb (ATL-HPA063713)

Atlas Antibodies

Catalog No: ATL-HPA063713-25

• 
• 

Product Description

Protein Description: calcium/calmodulin dependent protein kinase kinase 2
Gene Name: CAMKK2
Alternative Gene Name: CAMKK, CAMKKB, KIAA0787, MGC15254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 100%, ENSRNOG00000001309: 100%
Entrez Gene ID: 10645
Uniprot ID: Q96RR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
• Gene Sequence: FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
• Gene ID - Mouse: ENSMUSG00000029471
• Gene ID - Rat: ENSRNOG00000001309
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.