Protein Description: calcium/calmodulin dependent protein kinase II inhibitor 2
Gene Name: CAMK2N2
Alternative Gene Name: CaM-KIIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051146: 100%, ENSRNOG00000038184: 100%
Entrez Gene ID: 94032
Uniprot ID: Q96S95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAMK2N2
Alternative Gene Name: CaM-KIIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051146: 100%, ENSRNOG00000038184: 100%
Entrez Gene ID: 94032
Uniprot ID: Q96S95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM |
| Documents & Links for Anti CAMK2N2 pAb (ATL-HPA075200) | |
| Datasheet | Anti CAMK2N2 pAb (ATL-HPA075200) Datasheet (External Link) |
| Vendor Page | Anti CAMK2N2 pAb (ATL-HPA075200) at Atlas |
| Documents & Links for Anti CAMK2N2 pAb (ATL-HPA075200) | |
| Datasheet | Anti CAMK2N2 pAb (ATL-HPA075200) Datasheet (External Link) |
| Vendor Page | Anti CAMK2N2 pAb (ATL-HPA075200) |