![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104487/184773/atl-hpa071040_anti-calu-atl-hpa071040_68233__71535.1710523133.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104487/184773/atl-hpa071040_anti-calu-atl-hpa071040_68233__71535.1710523133.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.")
Polyclonal Antibody against Human CALU, Gene description: calumenin, Validated applications: ICC, Uniprot ID: O43852, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEE |
| Documents & Links for Anti-CALU pAb (ATL-HPA071040) | |
| Vendor Page | Anti-CALU pAb (ATL-HPA071040) at Atlas |
| Documents & Links for Anti-CALU pAb (ATL-HPA071040) | |
| Vendor Page | Anti-CALU pAb (ATL-HPA071040) |