Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)

Catalog No:
ATL-HPA064453-100
$486.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: calcitonin related polypeptide alpha
Gene Name: CALCA
Alternative Gene Name: CALC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030669: 78%, ENSRNOG00000011130: 81%
Entrez Gene ID: 796
Uniprot ID: P01258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS
Gene ID - Mouse ENSMUSG00000030669
Gene ID - Rat ENSMUSG00000030669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)
Datasheet Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) at Atlas

Documents & Links for Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)
Datasheet Anti CALCA pAb (ATL-HPA064453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALCA pAb (ATL-HPA064453 w/enhanced validation)