Anti CAD pAb (ATL-HPA069341 w/enhanced validation)

Catalog No:
ATL-HPA069341-25
$395.00

Description

Product Description

Protein Description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Gene Name: CAD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013629: 89%, ENSRNOG00000026474: 89%
Entrez Gene ID: 790
Uniprot ID: P27708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR
Gene Sequence SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR
Gene ID - Mouse ENSMUSG00000013629
Gene ID - Rat ENSRNOG00000026474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CAD pAb (ATL-HPA069341 w/enhanced validation)
Datasheet Anti CAD pAb (ATL-HPA069341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAD pAb (ATL-HPA069341 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAD pAb (ATL-HPA069341 w/enhanced validation)
Datasheet Anti CAD pAb (ATL-HPA069341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAD pAb (ATL-HPA069341 w/enhanced validation)

Product Description

Protein Description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Gene Name: CAD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013629: 89%, ENSRNOG00000026474: 89%
Entrez Gene ID: 790
Uniprot ID: P27708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR
Gene Sequence SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR
Gene ID - Mouse ENSMUSG00000013629
Gene ID - Rat ENSRNOG00000026474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CAD pAb (ATL-HPA069341 w/enhanced validation)
Datasheet Anti CAD pAb (ATL-HPA069341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAD pAb (ATL-HPA069341 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAD pAb (ATL-HPA069341 w/enhanced validation)
Datasheet Anti CAD pAb (ATL-HPA069341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAD pAb (ATL-HPA069341 w/enhanced validation)