Description
Product Description
Protein Description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Gene Name: CAD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 790
Uniprot ID: P27708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 790
Uniprot ID: P27708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL |
Gene Sequence | VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CAD pAb (ATL-HPA057266 w/enhanced validation) | |
Datasheet | Anti CAD pAb (ATL-HPA057266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAD pAb (ATL-HPA057266 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CAD pAb (ATL-HPA057266 w/enhanced validation) | |
Datasheet | Anti CAD pAb (ATL-HPA057266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAD pAb (ATL-HPA057266 w/enhanced validation) |