Anti CACYBP pAb (ATL-HPA057038)

Atlas Antibodies

Catalog No: ATL-HPA057038-25

• 

Product Description

Protein Description: calcyclin binding protein
Gene Name: CACYBP
Alternative Gene Name: S100A6BP, SIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014226: 94%, ENSRNOG00000002572: 94%
Entrez Gene ID: 27101
Uniprot ID: Q9HB71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGD
• Gene Sequence: CRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGD
• Gene ID - Mouse: ENSMUSG00000014226
• Gene ID - Rat: ENSRNOG00000002572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.