Protein Description: calcium channel, voltage-dependent, gamma subunit 4
Gene Name: CACNG4
Alternative Gene Name: MGC11138, MGC24983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020723: 94%, ENSRNOG00000003262: 94%
Entrez Gene ID: 27092
Uniprot ID: Q9UBN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CACNG4
Alternative Gene Name: MGC11138, MGC24983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020723: 94%, ENSRNOG00000003262: 94%
Entrez Gene ID: 27092
Uniprot ID: Q9UBN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV |
| Documents & Links for Anti CACNG4 pAb (ATL-HPA065370) | |
| Datasheet | Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link) |
| Vendor Page | Anti CACNG4 pAb (ATL-HPA065370) at Atlas |
| Documents & Links for Anti CACNG4 pAb (ATL-HPA065370) | |
| Datasheet | Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link) |
| Vendor Page | Anti CACNG4 pAb (ATL-HPA065370) |