Anti CACNG4 pAb (ATL-HPA065370)

Catalog No:
ATL-HPA065370-25
$303.00

Description

Product Description

Protein Description: calcium channel, voltage-dependent, gamma subunit 4
Gene Name: CACNG4
Alternative Gene Name: MGC11138, MGC24983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020723: 94%, ENSRNOG00000003262: 94%
Entrez Gene ID: 27092
Uniprot ID: Q9UBN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
Gene Sequence TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
Gene ID - Mouse ENSMUSG00000020723
Gene ID - Rat ENSRNOG00000003262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CACNG4 pAb (ATL-HPA065370)
Datasheet Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link)
Vendor Page Anti CACNG4 pAb (ATL-HPA065370) at Atlas Antibodies

Documents & Links for Anti CACNG4 pAb (ATL-HPA065370)
Datasheet Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link)
Vendor Page Anti CACNG4 pAb (ATL-HPA065370)

Product Description

Protein Description: calcium channel, voltage-dependent, gamma subunit 4
Gene Name: CACNG4
Alternative Gene Name: MGC11138, MGC24983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020723: 94%, ENSRNOG00000003262: 94%
Entrez Gene ID: 27092
Uniprot ID: Q9UBN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
Gene Sequence TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
Gene ID - Mouse ENSMUSG00000020723
Gene ID - Rat ENSRNOG00000003262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CACNG4 pAb (ATL-HPA065370)
Datasheet Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link)
Vendor Page Anti CACNG4 pAb (ATL-HPA065370) at Atlas Antibodies

Documents & Links for Anti CACNG4 pAb (ATL-HPA065370)
Datasheet Anti CACNG4 pAb (ATL-HPA065370) Datasheet (External Link)
Vendor Page Anti CACNG4 pAb (ATL-HPA065370)