Anti CACNG3 pAb (ATL-HPA077238 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA077238-25

• 

Product Description

Protein Description: calcium voltage-gated channel auxiliary subunit gamma 3
Gene Name: CACNG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066189: 95%, ENSRNOG00000012362: 95%
Entrez Gene ID: 10368
Uniprot ID: O60359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRS
• Gene Sequence: KHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRS
• Gene ID - Mouse: ENSMUSG00000066189
• Gene ID - Rat: ENSRNOG00000012362
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.