Anti CACNG3 pAb (ATL-HPA059010)

Catalog No:
ATL-HPA059010-25
$447.00

Description

Product Description

Protein Description: calcium channel, voltage-dependent, gamma subunit 3
Gene Name: CACNG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066189: 97%, ENSRNOG00000012362: 97%
Entrez Gene ID: 10368
Uniprot ID: O60359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN
Gene Sequence PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN
Gene ID - Mouse ENSMUSG00000066189
Gene ID - Rat ENSRNOG00000012362
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CACNG3 pAb (ATL-HPA059010)
Datasheet Anti CACNG3 pAb (ATL-HPA059010) Datasheet (External Link)
Vendor Page Anti CACNG3 pAb (ATL-HPA059010) at Atlas Antibodies

Documents & Links for Anti CACNG3 pAb (ATL-HPA059010)
Datasheet Anti CACNG3 pAb (ATL-HPA059010) Datasheet (External Link)
Vendor Page Anti CACNG3 pAb (ATL-HPA059010)

Product Description

Protein Description: calcium channel, voltage-dependent, gamma subunit 3
Gene Name: CACNG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066189: 97%, ENSRNOG00000012362: 97%
Entrez Gene ID: 10368
Uniprot ID: O60359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN
Gene Sequence PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN
Gene ID - Mouse ENSMUSG00000066189
Gene ID - Rat ENSRNOG00000012362
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CACNG3 pAb (ATL-HPA059010)
Datasheet Anti CACNG3 pAb (ATL-HPA059010) Datasheet (External Link)
Vendor Page Anti CACNG3 pAb (ATL-HPA059010) at Atlas Antibodies

Documents & Links for Anti CACNG3 pAb (ATL-HPA059010)
Datasheet Anti CACNG3 pAb (ATL-HPA059010) Datasheet (External Link)
Vendor Page Anti CACNG3 pAb (ATL-HPA059010)