Anti CACNA1F pAb (ATL-HPA068379)

Atlas Antibodies

Catalog No: ATL-HPA068379-25

• 

Product Description

Protein Description: calcium voltage-gated channel subunit alpha1 F
Gene Name: CACNA1F
Alternative Gene Name: AIED, Cav1.4, CORDX3, CSNB2, CSNB2A, CSNBX2, JM8, JMC8, OA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031142: 82%, ENSRNOG00000010348: 83%
Entrez Gene ID: 778
Uniprot ID: O60840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
• Gene Sequence: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
• Gene ID - Mouse: ENSMUSG00000031142
• Gene ID - Rat: ENSRNOG00000010348
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.