Protein Description: Cdk5 and Abl enzyme substrate 1
Gene Name: CABLES1
Alternative Gene Name: FLJ35924, HsT2563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%
Entrez Gene ID: 91768
Uniprot ID: Q8TDN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CABLES1
Alternative Gene Name: FLJ35924, HsT2563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%
Entrez Gene ID: 91768
Uniprot ID: Q8TDN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN |
Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) at Atlas |
Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) |