Protein Description: carbonic anhydrase XII
Gene Name: CA12
Alternative Gene Name: HsT18816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032373: 74%, ENSRNOG00000017766: 74%
Entrez Gene ID: 771
Uniprot ID: O43570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CA12
Alternative Gene Name: HsT18816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032373: 74%, ENSRNOG00000017766: 74%
Entrez Gene ID: 771
Uniprot ID: O43570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL |
| Documents & Links for Anti CA12 pAb (ATL-HPA073203) | |
| Datasheet | Anti CA12 pAb (ATL-HPA073203) Datasheet (External Link) |
| Vendor Page | Anti CA12 pAb (ATL-HPA073203) at Atlas |
| Documents & Links for Anti CA12 pAb (ATL-HPA073203) | |
| Datasheet | Anti CA12 pAb (ATL-HPA073203) Datasheet (External Link) |
| Vendor Page | Anti CA12 pAb (ATL-HPA073203) |