![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101658/181802/atl-hpa076627_anti-c9orf85-pab-atl-hpa076627_63470__60010.1681138212.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: chromosome 9 open reading frame 85
Gene Name: C9orf85
Alternative Gene Name: MGC61599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035171: 96%, ENSRNOG00000027161: 96%
Entrez Gene ID: 138241
Uniprot ID: Q96MD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf85
Alternative Gene Name: MGC61599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035171: 96%, ENSRNOG00000027161: 96%
Entrez Gene ID: 138241
Uniprot ID: Q96MD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLE |
| Documents & Links for Anti C9orf85 pAb (ATL-HPA076627) | |
| Datasheet | Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link) |
| Vendor Page | Anti C9orf85 pAb (ATL-HPA076627) at Atlas |
| Documents & Links for Anti C9orf85 pAb (ATL-HPA076627) | |
| Datasheet | Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link) |
| Vendor Page | Anti C9orf85 pAb (ATL-HPA076627) |