Anti C9orf85 pAb (ATL-HPA076627)

Catalog No:
ATL-HPA076627-100
$596.00

Description

Product Description

Protein Description: chromosome 9 open reading frame 85
Gene Name: C9orf85
Alternative Gene Name: MGC61599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035171: 96%, ENSRNOG00000027161: 96%
Entrez Gene ID: 138241
Uniprot ID: Q96MD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLE
Gene Sequence SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLE
Gene ID - Mouse ENSMUSG00000035171
Gene ID - Rat ENSRNOG00000027161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C9orf85 pAb (ATL-HPA076627)
Datasheet Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link)
Vendor Page Anti C9orf85 pAb (ATL-HPA076627) at Atlas Antibodies

Documents & Links for Anti C9orf85 pAb (ATL-HPA076627)
Datasheet Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link)
Vendor Page Anti C9orf85 pAb (ATL-HPA076627)

Product Description

Protein Description: chromosome 9 open reading frame 85
Gene Name: C9orf85
Alternative Gene Name: MGC61599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035171: 96%, ENSRNOG00000027161: 96%
Entrez Gene ID: 138241
Uniprot ID: Q96MD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLE
Gene Sequence SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLE
Gene ID - Mouse ENSMUSG00000035171
Gene ID - Rat ENSRNOG00000027161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C9orf85 pAb (ATL-HPA076627)
Datasheet Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link)
Vendor Page Anti C9orf85 pAb (ATL-HPA076627) at Atlas Antibodies

Documents & Links for Anti C9orf85 pAb (ATL-HPA076627)
Datasheet Anti C9orf85 pAb (ATL-HPA076627) Datasheet (External Link)
Vendor Page Anti C9orf85 pAb (ATL-HPA076627)