Protein Description: chromosome 9 open reading frame 69
Gene Name: C9orf69
Alternative Gene Name: bA83N9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037583: 29%, ENSRNOG00000042501: 96%
Entrez Gene ID: 90120
Uniprot ID: H0YL14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf69
Alternative Gene Name: bA83N9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037583: 29%, ENSRNOG00000042501: 96%
Entrez Gene ID: 90120
Uniprot ID: H0YL14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLY |
| Documents & Links for Anti C9orf69 pAb (ATL-HPA066070) | |
| Datasheet | Anti C9orf69 pAb (ATL-HPA066070) Datasheet (External Link) |
| Vendor Page | Anti C9orf69 pAb (ATL-HPA066070) at Atlas |
| Documents & Links for Anti C9orf69 pAb (ATL-HPA066070) | |
| Datasheet | Anti C9orf69 pAb (ATL-HPA066070) Datasheet (External Link) |
| Vendor Page | Anti C9orf69 pAb (ATL-HPA066070) |