Protein Description: chromosome 9 open reading frame 3
Gene Name: C9orf3
Alternative Gene Name: AOPEP, AP-O, APO, C90RF3, FLJ14675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021458: 86%, ENSRNOG00000017505: 90%
Entrez Gene ID: 84909
Uniprot ID: Q8N6M6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf3
Alternative Gene Name: AOPEP, AP-O, APO, C90RF3, FLJ14675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021458: 86%, ENSRNOG00000017505: 90%
Entrez Gene ID: 84909
Uniprot ID: Q8N6M6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT |
Documents & Links for Anti C9orf3 pAb (ATL-HPA072729) | |
Datasheet | Anti C9orf3 pAb (ATL-HPA072729) Datasheet (External Link) |
Vendor Page | Anti C9orf3 pAb (ATL-HPA072729) at Atlas |
Documents & Links for Anti C9orf3 pAb (ATL-HPA072729) | |
Datasheet | Anti C9orf3 pAb (ATL-HPA072729) Datasheet (External Link) |
Vendor Page | Anti C9orf3 pAb (ATL-HPA072729) |