Description
Product Description
Protein Description: chromosome 9 open reading frame 153
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS |
Gene Sequence | LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS |
Gene ID - Mouse | ENSMUSG00000049902 |
Gene ID - Rat | ENSRNOG00000042206 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C9orf153 pAb (ATL-HPA079466) | |
Datasheet | Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link) |
Vendor Page | Anti C9orf153 pAb (ATL-HPA079466) at Atlas Antibodies |
Documents & Links for Anti C9orf153 pAb (ATL-HPA079466) | |
Datasheet | Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link) |
Vendor Page | Anti C9orf153 pAb (ATL-HPA079466) |