Protein Description: chromosome 9 open reading frame 153
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C9orf153
Alternative Gene Name: bA507D14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049902: 39%, ENSRNOG00000042206: 42%
Entrez Gene ID: 389766
Uniprot ID: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS |
| Documents & Links for Anti C9orf153 pAb (ATL-HPA079466) | |
| Datasheet | Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link) |
| Vendor Page | Anti C9orf153 pAb (ATL-HPA079466) at Atlas |
| Documents & Links for Anti C9orf153 pAb (ATL-HPA079466) | |
| Datasheet | Anti C9orf153 pAb (ATL-HPA079466) Datasheet (External Link) |
| Vendor Page | Anti C9orf153 pAb (ATL-HPA079466) |