Description
Product Description
Protein Description: chromosome 8 open reading frame 88
Gene Name: C8orf88
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050930: 29%, ENSRNOG00000047537: 92%
Entrez Gene ID: 100127983
Uniprot ID: P0DMB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C8orf88
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050930: 29%, ENSRNOG00000047537: 92%
Entrez Gene ID: 100127983
Uniprot ID: P0DMB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK |
Gene Sequence | METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK |
Gene ID - Mouse | ENSMUSG00000050930 |
Gene ID - Rat | ENSRNOG00000047537 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) | |
Datasheet | Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) | |
Datasheet | Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation) |