Anti C8orf88 pAb (ATL-HPA078486 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA078486-25

• 

Product Description

Protein Description: chromosome 8 open reading frame 88
Gene Name: C8orf88
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050930: 29%, ENSRNOG00000047537: 92%
Entrez Gene ID: 100127983
Uniprot ID: P0DMB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK
• Gene Sequence: METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK
• Gene ID - Mouse: ENSMUSG00000050930
• Gene ID - Rat: ENSRNOG00000047537
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.