Protein Description: chromosome 5 open reading frame 51
Gene Name: C5orf51
Alternative Gene Name: LOC285636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041935: 99%, ENSRNOG00000052775: 98%
Entrez Gene ID: 285636
Uniprot ID: A6NDU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C5orf51
Alternative Gene Name: LOC285636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041935: 99%, ENSRNOG00000052775: 98%
Entrez Gene ID: 285636
Uniprot ID: A6NDU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED |
| Documents & Links for Anti C5orf51 pAb (ATL-HPA063816) | |
| Datasheet | Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link) |
| Vendor Page | Anti C5orf51 pAb (ATL-HPA063816) at Atlas |
| Documents & Links for Anti C5orf51 pAb (ATL-HPA063816) | |
| Datasheet | Anti C5orf51 pAb (ATL-HPA063816) Datasheet (External Link) |
| Vendor Page | Anti C5orf51 pAb (ATL-HPA063816) |