Protein Description: chromosome 5 open reading frame 38
Gene Name: C5orf38
Alternative Gene Name: CEI, IRX2NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025724: 27%, ENSRNOG00000011029: 27%
Entrez Gene ID: 153571
Uniprot ID: Q86SI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C5orf38
Alternative Gene Name: CEI, IRX2NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025724: 27%, ENSRNOG00000011029: 27%
Entrez Gene ID: 153571
Uniprot ID: Q86SI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC |
Documents & Links for Anti C5orf38 pAb (ATL-HPA073667) | |
Datasheet | Anti C5orf38 pAb (ATL-HPA073667) Datasheet (External Link) |
Vendor Page | Anti C5orf38 pAb (ATL-HPA073667) at Atlas |
Documents & Links for Anti C5orf38 pAb (ATL-HPA073667) | |
Datasheet | Anti C5orf38 pAb (ATL-HPA073667) Datasheet (External Link) |
Vendor Page | Anti C5orf38 pAb (ATL-HPA073667) |