Anti C5orf38 pAb (ATL-HPA073667)

Atlas Antibodies

Catalog No: ATL-HPA073667-25

• 

Product Description

Protein Description: chromosome 5 open reading frame 38
Gene Name: C5orf38
Alternative Gene Name: CEI, IRX2NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025724: 27%, ENSRNOG00000011029: 27%
Entrez Gene ID: 153571
Uniprot ID: Q86SI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC
• Gene Sequence: HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC
• Gene ID - Mouse: ENSMUSG00000025724
• Gene ID - Rat: ENSRNOG00000011029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.