Anti C5orf24 pAb (ATL-HPA062502)

Atlas Antibodies

Catalog No: ATL-HPA062502-25

• 

Product Description

Protein Description: chromosome 5 open reading frame 24
Gene Name: C5orf24
Alternative Gene Name: FLJ37562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045767: 100%, ENSRNOG00000047934: 100%
Entrez Gene ID: 134553
Uniprot ID: Q7Z6I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRP
• Gene Sequence: RPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRP
• Gene ID - Mouse: ENSMUSG00000045767
• Gene ID - Rat: ENSRNOG00000047934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.