Description
Product Description
Protein Description: chromosome 4 open reading frame 47
Gene Name: C4orf47
Alternative Gene Name: LOC441054
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071103: 66%, ENSRNOG00000038819: 67%
Entrez Gene ID: 441054
Uniprot ID: A7E2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C4orf47
Alternative Gene Name: LOC441054
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071103: 66%, ENSRNOG00000038819: 67%
Entrez Gene ID: 441054
Uniprot ID: A7E2U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSEESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKLANISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKNYKTSSVP |
Gene Sequence | FSEESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKLANISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKNYKTSSVP |
Gene ID - Mouse | ENSMUSG00000071103 |
Gene ID - Rat | ENSRNOG00000038819 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) | |
Datasheet | Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) | |
Datasheet | Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C4orf47 pAb (ATL-HPA063485 w/enhanced validation) |