Anti C4orf33 pAb (ATL-HPA061199)

Catalog No:
ATL-HPA061199-25
$447.00

Description

Product Description

Protein Description: chromosome 4 open reading frame 33
Gene Name: C4orf33
Alternative Gene Name: FLJ33703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025766: 84%, ENSRNOG00000038330: 84%
Entrez Gene ID: 132321
Uniprot ID: Q8N1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI
Gene Sequence TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI
Gene ID - Mouse ENSMUSG00000025766
Gene ID - Rat ENSRNOG00000038330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C4orf33 pAb (ATL-HPA061199)
Datasheet Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link)
Vendor Page Anti C4orf33 pAb (ATL-HPA061199) at Atlas Antibodies

Documents & Links for Anti C4orf33 pAb (ATL-HPA061199)
Datasheet Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link)
Vendor Page Anti C4orf33 pAb (ATL-HPA061199)

Product Description

Protein Description: chromosome 4 open reading frame 33
Gene Name: C4orf33
Alternative Gene Name: FLJ33703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025766: 84%, ENSRNOG00000038330: 84%
Entrez Gene ID: 132321
Uniprot ID: Q8N1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI
Gene Sequence TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI
Gene ID - Mouse ENSMUSG00000025766
Gene ID - Rat ENSRNOG00000038330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C4orf33 pAb (ATL-HPA061199)
Datasheet Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link)
Vendor Page Anti C4orf33 pAb (ATL-HPA061199) at Atlas Antibodies

Documents & Links for Anti C4orf33 pAb (ATL-HPA061199)
Datasheet Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link)
Vendor Page Anti C4orf33 pAb (ATL-HPA061199)