Description
Product Description
Protein Description: chromosome 4 open reading frame 33
Gene Name: C4orf33
Alternative Gene Name: FLJ33703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025766: 84%, ENSRNOG00000038330: 84%
Entrez Gene ID: 132321
Uniprot ID: Q8N1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C4orf33
Alternative Gene Name: FLJ33703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025766: 84%, ENSRNOG00000038330: 84%
Entrez Gene ID: 132321
Uniprot ID: Q8N1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI |
Gene Sequence | TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLI |
Gene ID - Mouse | ENSMUSG00000025766 |
Gene ID - Rat | ENSRNOG00000038330 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C4orf33 pAb (ATL-HPA061199) | |
Datasheet | Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link) |
Vendor Page | Anti C4orf33 pAb (ATL-HPA061199) at Atlas Antibodies |
Documents & Links for Anti C4orf33 pAb (ATL-HPA061199) | |
Datasheet | Anti C4orf33 pAb (ATL-HPA061199) Datasheet (External Link) |
Vendor Page | Anti C4orf33 pAb (ATL-HPA061199) |