Anti C4orf32 pAb (ATL-HPA069294)

Atlas Antibodies

Catalog No: ATL-HPA069294-25

• 

Product Description

Protein Description: chromosome 4 open reading frame 32
Gene Name: C4orf32
Alternative Gene Name: FLJ39370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021194: 39%, ENSRNOG00000010875: 53%
Entrez Gene ID: 132720
Uniprot ID: Q8N8J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GERDEDGDALAEREAAGTEWDPGASPRRRGQRPKESEQDVEDSQN
• Gene Sequence: GERDEDGDALAEREAAGTEWDPGASPRRRGQRPKESEQDVEDSQN
• Gene ID - Mouse: ENSMUSG00000021194
• Gene ID - Rat: ENSRNOG00000010875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.