Description
Product Description
Protein Description: chromosome 4 open reading frame 32
Gene Name: C4orf32
Alternative Gene Name: FLJ39370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050549: 91%, ENSRNOG00000010875: 91%
Entrez Gene ID: 132720
Uniprot ID: Q8N8J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C4orf32
Alternative Gene Name: FLJ39370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050549: 91%, ENSRNOG00000010875: 91%
Entrez Gene ID: 132720
Uniprot ID: Q8N8J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
| Gene Sequence | NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
| Gene ID - Mouse | ENSMUSG00000050549 |
| Gene ID - Rat | ENSRNOG00000010875 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti C4orf32 pAb (ATL-HPA062443) | |
| Datasheet | Anti C4orf32 pAb (ATL-HPA062443) Datasheet (External Link) |
| Vendor Page | Anti C4orf32 pAb (ATL-HPA062443) at Atlas Antibodies |
| Documents & Links for Anti C4orf32 pAb (ATL-HPA062443) | |
| Datasheet | Anti C4orf32 pAb (ATL-HPA062443) Datasheet (External Link) |
| Vendor Page | Anti C4orf32 pAb (ATL-HPA062443) |