Protein Description: chromosome 3 open reading frame 67
Gene Name: C3orf67
Alternative Gene Name: FLJ42117, FLJ42930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021747: 88%, ENSRNOG00000007206: 84%
Entrez Gene ID: 200844
Uniprot ID: Q6ZVT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C3orf67
Alternative Gene Name: FLJ42117, FLJ42930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021747: 88%, ENSRNOG00000007206: 84%
Entrez Gene ID: 200844
Uniprot ID: Q6ZVT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDLVAFTSEIFKGAVFQSLDGIVVSANCKLRKIFTLKSKPQDTADKDAVYGVPFSTDEPTDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAE |
| Documents & Links for Anti C3orf67 pAb (ATL-HPA069696) | |
| Datasheet | Anti C3orf67 pAb (ATL-HPA069696) Datasheet (External Link) |
| Vendor Page | Anti C3orf67 pAb (ATL-HPA069696) at Atlas |
| Documents & Links for Anti C3orf67 pAb (ATL-HPA069696) | |
| Datasheet | Anti C3orf67 pAb (ATL-HPA069696) Datasheet (External Link) |
| Vendor Page | Anti C3orf67 pAb (ATL-HPA069696) |