Description
Product Description
Protein Description: chromosome 3 open reading frame 30
Gene Name: C3orf30
Alternative Gene Name: FLJ32859
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022798: 40%, ENSRNOG00000042555: 42%
Entrez Gene ID: 152405
Uniprot ID: Q96M34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C3orf30
Alternative Gene Name: FLJ32859
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022798: 40%, ENSRNOG00000042555: 42%
Entrez Gene ID: 152405
Uniprot ID: Q96M34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQITHRLSKLSERRPSVQIDSGSSVPSDQSP |
Gene Sequence | QAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQITHRLSKLSERRPSVQIDSGSSVPSDQSP |
Gene ID - Mouse | ENSMUSG00000022798 |
Gene ID - Rat | ENSRNOG00000042555 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) | |
Datasheet | Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) | |
Datasheet | Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C3orf30 pAb (ATL-HPA062468 w/enhanced validation) |