Anti C2orf73 pAb (ATL-HPA059596)

Atlas Antibodies

Catalog No: ATL-HPA059596-25

• 

Product Description

Protein Description: chromosome 2 open reading frame 73
Gene Name: C2orf73
Alternative Gene Name: FLJ40298
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040919: 74%, ENSRNOG00000006356: 72%
Entrez Gene ID: 129852
Uniprot ID: Q8N5S3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA
• Gene Sequence: SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA
• Gene ID - Mouse: ENSMUSG00000040919
• Gene ID - Rat: ENSRNOG00000006356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.