Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062894-25

• 

Product Description

Protein Description: chromosome 2 open reading frame 50
Gene Name: C2orf50
Alternative Gene Name: FLJ25143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071398: 54%, ENSRNOG00000024338: 54%
Entrez Gene ID: 130813
Uniprot ID: Q96LR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRV
• Gene Sequence: MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRV
• Gene ID - Mouse: ENSMUSG00000071398
• Gene ID - Rat: ENSRNOG00000024338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.