Protein Description: chromosome 2 open reading frame 50
Gene Name: C2orf50
Alternative Gene Name: FLJ25143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071398: 54%, ENSRNOG00000024338: 54%
Entrez Gene ID: 130813
Uniprot ID: Q96LR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C2orf50
Alternative Gene Name: FLJ25143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071398: 54%, ENSRNOG00000024338: 54%
Entrez Gene ID: 130813
Uniprot ID: Q96LR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRV |
Documents & Links for Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) | |
Datasheet | Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) at Atlas |
Documents & Links for Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) | |
Datasheet | Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C2orf50 pAb (ATL-HPA062894 w/enhanced validation) |