Description
Product Description
Protein Description: chromosome 22 open reading frame 39
Gene Name: C22orf39
Alternative Gene Name: MGC74441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071632: 76%, ENSRNOG00000048861: 69%
Entrez Gene ID: 128977
Uniprot ID: Q6P5X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C22orf39
Alternative Gene Name: MGC74441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071632: 76%, ENSRNOG00000048861: 69%
Entrez Gene ID: 128977
Uniprot ID: Q6P5X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE |
Gene Sequence | AEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE |
Gene ID - Mouse | ENSMUSG00000071632 |
Gene ID - Rat | ENSRNOG00000048861 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C22orf39 pAb (ATL-HPA073701) | |
Datasheet | Anti C22orf39 pAb (ATL-HPA073701) Datasheet (External Link) |
Vendor Page | Anti C22orf39 pAb (ATL-HPA073701) at Atlas Antibodies |
Documents & Links for Anti C22orf39 pAb (ATL-HPA073701) | |
Datasheet | Anti C22orf39 pAb (ATL-HPA073701) Datasheet (External Link) |
Vendor Page | Anti C22orf39 pAb (ATL-HPA073701) |