Description
Product Description
Protein Description: chromosome 22 open reading frame 31
Gene Name: C22orf31
Alternative Gene Name: bK747E2.1, HS747E2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026360: 18%, ENSRNOG00000010846: 20%
Entrez Gene ID: 25770
Uniprot ID: O95567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C22orf31
Alternative Gene Name: bK747E2.1, HS747E2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026360: 18%, ENSRNOG00000010846: 20%
Entrez Gene ID: 25770
Uniprot ID: O95567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNINAPAPATTSSWEVVRNPLIASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQARKRNFISSKSKQPAGHRR |
Gene Sequence | HPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNINAPAPATTSSWEVVRNPLIASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQARKRNFISSKSKQPAGHRR |
Gene ID - Mouse | ENSMUSG00000026360 |
Gene ID - Rat | ENSRNOG00000010846 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C22orf31 pAb (ATL-HPA068522) | |
Datasheet | Anti C22orf31 pAb (ATL-HPA068522) Datasheet (External Link) |
Vendor Page | Anti C22orf31 pAb (ATL-HPA068522) at Atlas Antibodies |
Documents & Links for Anti C22orf31 pAb (ATL-HPA068522) | |
Datasheet | Anti C22orf31 pAb (ATL-HPA068522) Datasheet (External Link) |
Vendor Page | Anti C22orf31 pAb (ATL-HPA068522) |