Description
Product Description
Protein Description: chromosome 20 open reading frame 85
Gene Name: C20orf85
Alternative Gene Name: bA196N14.1, LLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027518: 67%, ENSRNOG00000028533: 69%
Entrez Gene ID: 128602
Uniprot ID: Q9H1P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C20orf85
Alternative Gene Name: bA196N14.1, LLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027518: 67%, ENSRNOG00000028533: 69%
Entrez Gene ID: 128602
Uniprot ID: Q9H1P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH |
Gene Sequence | FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH |
Gene ID - Mouse | ENSMUSG00000027518 |
Gene ID - Rat | ENSRNOG00000028533 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) | |
Datasheet | Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) | |
Datasheet | Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C20orf85 pAb (ATL-HPA065540 w/enhanced validation) |