Protein Description: chromosome 20 open reading frame 194
Gene Name: C20orf194
Alternative Gene Name: DKFZp434N061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027309: 94%, ENSRNOG00000021237: 96%
Entrez Gene ID: 25943
Uniprot ID: Q5TEA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C20orf194
Alternative Gene Name: DKFZp434N061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027309: 94%, ENSRNOG00000021237: 96%
Entrez Gene ID: 25943
Uniprot ID: Q5TEA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE |
| Documents & Links for Anti C20orf194 pAb (ATL-HPA067418) | |
| Datasheet | Anti C20orf194 pAb (ATL-HPA067418) Datasheet (External Link) |
| Vendor Page | Anti C20orf194 pAb (ATL-HPA067418) at Atlas |
| Documents & Links for Anti C20orf194 pAb (ATL-HPA067418) | |
| Datasheet | Anti C20orf194 pAb (ATL-HPA067418) Datasheet (External Link) |
| Vendor Page | Anti C20orf194 pAb (ATL-HPA067418) |