Description
Product Description
Protein Description: chromosome 20 open reading frame 194
Gene Name: C20orf194
Alternative Gene Name: DKFZp434N061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027309: 94%, ENSRNOG00000021237: 96%
Entrez Gene ID: 25943
Uniprot ID: Q5TEA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C20orf194
Alternative Gene Name: DKFZp434N061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027309: 94%, ENSRNOG00000021237: 96%
Entrez Gene ID: 25943
Uniprot ID: Q5TEA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE |
Gene Sequence | ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE |
Gene ID - Mouse | ENSMUSG00000027309 |
Gene ID - Rat | ENSRNOG00000021237 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C20orf194 pAb (ATL-HPA067418) | |
Datasheet | Anti C20orf194 pAb (ATL-HPA067418) Datasheet (External Link) |
Vendor Page | Anti C20orf194 pAb (ATL-HPA067418) at Atlas Antibodies |
Documents & Links for Anti C20orf194 pAb (ATL-HPA067418) | |
Datasheet | Anti C20orf194 pAb (ATL-HPA067418) Datasheet (External Link) |
Vendor Page | Anti C20orf194 pAb (ATL-HPA067418) |