Anti C1QTNF8 pAb (ATL-HPA056438)

Atlas Antibodies

Catalog No: ATL-HPA056438-25

• 

Product Description

Protein Description: C1q and tumor necrosis factor related protein 8
Gene Name: C1QTNF8
Alternative Gene Name: CTRP8, UNQ5829
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017446: 56%, ENSRNOG00000003259: 56%
Entrez Gene ID: 390664
Uniprot ID: P60827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV
• Gene Sequence: ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV
• Gene ID - Mouse: ENSMUSG00000017446
• Gene ID - Rat: ENSRNOG00000003259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.