Anti C1QTNF3 pAb (ATL-HPA066011)

Catalog No:
ATL-HPA066011-25
$401.00
Protein Description: C1q and tumor necrosis factor related protein 3
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 94%, ENSRNOG00000018570: 73%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG

Documents & Links for Anti C1QTNF3 pAb (ATL-HPA066011)
Datasheet Anti C1QTNF3 pAb (ATL-HPA066011) Datasheet (External Link)
Vendor Page Anti C1QTNF3 pAb (ATL-HPA066011) at Atlas

Documents & Links for Anti C1QTNF3 pAb (ATL-HPA066011)
Datasheet Anti C1QTNF3 pAb (ATL-HPA066011) Datasheet (External Link)
Vendor Page Anti C1QTNF3 pAb (ATL-HPA066011)