Protein Description: C1q and tumor necrosis factor related protein 3
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 94%, ENSRNOG00000018570: 73%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 94%, ENSRNOG00000018570: 73%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG |
Documents & Links for Anti C1QTNF3 pAb (ATL-HPA066011) | |
Datasheet | Anti C1QTNF3 pAb (ATL-HPA066011) Datasheet (External Link) |
Vendor Page | Anti C1QTNF3 pAb (ATL-HPA066011) at Atlas |
Documents & Links for Anti C1QTNF3 pAb (ATL-HPA066011) | |
Datasheet | Anti C1QTNF3 pAb (ATL-HPA066011) Datasheet (External Link) |
Vendor Page | Anti C1QTNF3 pAb (ATL-HPA066011) |