Description
Product Description
Protein Description: C1q and tumor necrosis factor related protein 3
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 98%, ENSRNOG00000018570: 98%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 98%, ENSRNOG00000018570: 98%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET |
Gene Sequence | MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET |
Gene ID - Mouse | ENSMUSG00000058914 |
Gene ID - Rat | ENSRNOG00000018570 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C1QTNF3 pAb (ATL-HPA064996) | |
Datasheet | Anti C1QTNF3 pAb (ATL-HPA064996) Datasheet (External Link) |
Vendor Page | Anti C1QTNF3 pAb (ATL-HPA064996) at Atlas Antibodies |
Documents & Links for Anti C1QTNF3 pAb (ATL-HPA064996) | |
Datasheet | Anti C1QTNF3 pAb (ATL-HPA064996) Datasheet (External Link) |
Vendor Page | Anti C1QTNF3 pAb (ATL-HPA064996) |