Anti C1QTNF2 pAb (ATL-HPA061290)

Atlas Antibodies

Catalog No: ATL-HPA061290-25

• 
• 

Product Description

Protein Description: C1q and tumor necrosis factor related protein 2
Gene Name: C1QTNF2
Alternative Gene Name: CTRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046491: 61%, ENSRNOG00000003870: 52%
Entrez Gene ID: 114898
Uniprot ID: Q9BXJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAEESRDAEPRRELLCSGRPWTWRAAARVTTMIPWVLLACALPCAADPLLGASARRDFRKGSPQLVCSLPG
• Gene Sequence: AAEESRDAEPRRELLCSGRPWTWRAAARVTTMIPWVLLACALPCAADPLLGASARRDFRKGSPQLVCSLPG
• Gene ID - Mouse: ENSMUSG00000046491
• Gene ID - Rat: ENSRNOG00000003870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.