Protein Description: chromosome 1 open reading frame 226
Gene Name: C1orf226
Alternative Gene Name: FLJ13137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102752: 78%, ENSRNOG00000042929: 75%
Entrez Gene ID: 400793
Uniprot ID: A1L170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C1orf226
Alternative Gene Name: FLJ13137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102752: 78%, ENSRNOG00000042929: 75%
Entrez Gene ID: 400793
Uniprot ID: A1L170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSG |
| Documents & Links for Anti C1orf226 pAb (ATL-HPA074060) | |
| Datasheet | Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link) |
| Vendor Page | Anti C1orf226 pAb (ATL-HPA074060) at Atlas |
| Documents & Links for Anti C1orf226 pAb (ATL-HPA074060) | |
| Datasheet | Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link) |
| Vendor Page | Anti C1orf226 pAb (ATL-HPA074060) |