Protein Description: chromosome 1 open reading frame 174
Gene Name: C1orf174
Alternative Gene Name: RP13-531C17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047613: 67%, ENSRNOG00000025034: 65%
Entrez Gene ID: 339448
Uniprot ID: Q8IYL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C1orf174
Alternative Gene Name: RP13-531C17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047613: 67%, ENSRNOG00000025034: 65%
Entrez Gene ID: 339448
Uniprot ID: Q8IYL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RLKARSCSAARLASAQEVAGSTSAKTACLTSSSHKATDRRTSKKFKCDKGHLVKSELQKLVPKNDSASLPKVTPETPCENEFAEGSALLPGSEAGVSVQQGAASLPLGGC |
| Documents & Links for Anti C1orf174 pAb (ATL-HPA065778) | |
| Datasheet | Anti C1orf174 pAb (ATL-HPA065778) Datasheet (External Link) |
| Vendor Page | Anti C1orf174 pAb (ATL-HPA065778) at Atlas |
| Documents & Links for Anti C1orf174 pAb (ATL-HPA065778) | |
| Datasheet | Anti C1orf174 pAb (ATL-HPA065778) Datasheet (External Link) |
| Vendor Page | Anti C1orf174 pAb (ATL-HPA065778) |