Description
Product Description
Protein Description: chromosome 1 open reading frame 159
Gene Name: C1orf159
Alternative Gene Name: FLJ20584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059939: 63%, ENSRNOG00000020199: 64%
Entrez Gene ID: 54991
Uniprot ID: Q96HA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C1orf159
Alternative Gene Name: FLJ20584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059939: 63%, ENSRNOG00000020199: 64%
Entrez Gene ID: 54991
Uniprot ID: Q96HA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG |
Gene Sequence | SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG |
Gene ID - Mouse | ENSMUSG00000059939 |
Gene ID - Rat | ENSRNOG00000020199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C1orf159 pAb (ATL-HPA075399) | |
Datasheet | Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link) |
Vendor Page | Anti C1orf159 pAb (ATL-HPA075399) at Atlas Antibodies |
Documents & Links for Anti C1orf159 pAb (ATL-HPA075399) | |
Datasheet | Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link) |
Vendor Page | Anti C1orf159 pAb (ATL-HPA075399) |