Anti C19orf84 pAb (ATL-HPA068082)

Atlas Antibodies

Catalog No: ATL-HPA068082-25

• 

Product Description

Protein Description: chromosome 19 open reading frame 84
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE
• Gene Sequence: PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE
• Gene ID - Mouse: ENSMUSG00000093639
• Gene ID - Rat: ENSRNOG00000010881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.