Protein Description: chromosome 19 open reading frame 84
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE |
| Documents & Links for Anti C19orf84 pAb (ATL-HPA068082) | |
| Datasheet | Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link) |
| Vendor Page | Anti C19orf84 pAb (ATL-HPA068082) at Atlas |
| Documents & Links for Anti C19orf84 pAb (ATL-HPA068082) | |
| Datasheet | Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link) |
| Vendor Page | Anti C19orf84 pAb (ATL-HPA068082) |