Description
Product Description
Protein Description: chromosome 19 open reading frame 84
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE |
Gene Sequence | PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE |
Gene ID - Mouse | ENSMUSG00000093639 |
Gene ID - Rat | ENSRNOG00000010881 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C19orf84 pAb (ATL-HPA068082) | |
Datasheet | Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link) |
Vendor Page | Anti C19orf84 pAb (ATL-HPA068082) at Atlas Antibodies |
Documents & Links for Anti C19orf84 pAb (ATL-HPA068082) | |
Datasheet | Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link) |
Vendor Page | Anti C19orf84 pAb (ATL-HPA068082) |