Anti C19orf68 pAb (ATL-HPA061028)

Atlas Antibodies

Catalog No: ATL-HPA061028-25

• 
• 

Product Description

Protein Description: chromosome 19 open reading frame 68
Gene Name: C19orf68
Alternative Gene Name: LOC374920
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070814: 90%, ENSRNOG00000014186: 87%
Entrez Gene ID: 374920
Uniprot ID: Q86XI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVETVFFLTSRTRALLRRFPRMLLVDRL
• Gene Sequence: RRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVETVFFLTSRTRALLRRFPRMLLVDRL
• Gene ID - Mouse: ENSMUSG00000070814
• Gene ID - Rat: ENSRNOG00000014186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.