Description
Product Description
Protein Description: chromosome 19 open reading frame 54
Gene Name: C19orf54
Alternative Gene Name: FLJ41131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078786: 77%, ENSRNOG00000037715: 79%
Entrez Gene ID: 284325
Uniprot ID: Q5BKX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf54
Alternative Gene Name: FLJ41131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078786: 77%, ENSRNOG00000037715: 79%
Entrez Gene ID: 284325
Uniprot ID: Q5BKX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVL |
Gene Sequence | CGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVL |
Gene ID - Mouse | ENSMUSG00000078786 |
Gene ID - Rat | ENSRNOG00000037715 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C19orf54 pAb (ATL-HPA059043) | |
Datasheet | Anti C19orf54 pAb (ATL-HPA059043) Datasheet (External Link) |
Vendor Page | Anti C19orf54 pAb (ATL-HPA059043) at Atlas Antibodies |
Documents & Links for Anti C19orf54 pAb (ATL-HPA059043) | |
Datasheet | Anti C19orf54 pAb (ATL-HPA059043) Datasheet (External Link) |
Vendor Page | Anti C19orf54 pAb (ATL-HPA059043) |