Anti C19orf35 pAb (ATL-HPA057806)

Atlas Antibodies

Catalog No: ATL-HPA057806-25

• 

Product Description

Protein Description: chromosome 19 open reading frame 35
Gene Name: C19orf35
Alternative Gene Name: FLJ45778
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074305: 36%, ENSRNOG00000042519: 36%
Entrez Gene ID: 374872
Uniprot ID: Q6ZS72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALVELRPENLL
• Gene Sequence: AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALVELRPENLL
• Gene ID - Mouse: ENSMUSG00000074305
• Gene ID - Rat: ENSRNOG00000042519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.