Protein Description: chromosome 19 open reading frame 25
Gene Name: C19orf25
Alternative Gene Name: FLJ36666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020133: 93%, ENSRNOG00000016399: 93%
Entrez Gene ID: 148223
Uniprot ID: Q9UFG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C19orf25
Alternative Gene Name: FLJ36666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020133: 93%, ENSRNOG00000016399: 93%
Entrez Gene ID: 148223
Uniprot ID: Q9UFG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MGSKAKKRVLLPTRPAPPTVEQILEDVRGA |
| Documents & Links for Anti C19orf25 pAb (ATL-HPA067491) | |
| Datasheet | Anti C19orf25 pAb (ATL-HPA067491) Datasheet (External Link) |
| Vendor Page | Anti C19orf25 pAb (ATL-HPA067491) at Atlas |
| Documents & Links for Anti C19orf25 pAb (ATL-HPA067491) | |
| Datasheet | Anti C19orf25 pAb (ATL-HPA067491) Datasheet (External Link) |
| Vendor Page | Anti C19orf25 pAb (ATL-HPA067491) |