Protein Description: chromosome 18 open reading frame 21
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 59%, ENSRNOG00000015546: 56%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 59%, ENSRNOG00000015546: 56%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG |
Documents & Links for Anti C18orf21 pAb (ATL-HPA067322) | |
Datasheet | Anti C18orf21 pAb (ATL-HPA067322) Datasheet (External Link) |
Vendor Page | Anti C18orf21 pAb (ATL-HPA067322) at Atlas |
Documents & Links for Anti C18orf21 pAb (ATL-HPA067322) | |
Datasheet | Anti C18orf21 pAb (ATL-HPA067322) Datasheet (External Link) |
Vendor Page | Anti C18orf21 pAb (ATL-HPA067322) |